SCOPe 2.08: Domain d3b3ia2: 3b3i A:1-181

Lineage for d3b3ia2 (3b3i A:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-B27 [TaxId:9606] [54471] (9 PDB entries)
   Uniprot P03989 25-300

8. Domain d3b3ia2: 3b3i A:1-181 [154807]
   Other proteins in same PDB: d3b3ia1, d3b3ib2, d3b3ib3
   automated match to d1k5na2
   complexed with gol

Details for d3b3ia2

PDB Entry: 3b3i, 1.86 Å

PDB Description: citrullination-dependent differential presentation of a self-peptide by hla-b27 subtypes

PDB Compounds: (A:) HLA class I histocompatibility antigen, B-27 alpha chain

SCOPe Domain Sequences for d3b3ia2:

Sequence; same for both SEQRES and ATOM records:

>d3b3ia2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B27 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqhaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

Timeline for d3b3ia2:

• d3b3ia2 first appeared in SCOP 1.75
  
• d3b3ia2 appears in SCOPe 2.07