SCOPe 2.01: Domain d3b3ia1: 3b3i A:182-276

Lineage for d3b3ia1 (3b3i A:182-276)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (157 PDB entries)
   Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor

8. Domain d3b3ia1: 3b3i A:182-276 [154806]
   Other proteins in same PDB: d3b3ia2, d3b3ib_
   automatically matched to d1m6oa1
   complexed with gol

Details for d3b3ia1

PDB Entry: 3b3i, 1.86 Å

PDB Description: citrullination-dependent differential presentation of a self-peptide by hla-b27 subtypes

PDB Compounds: (A:) HLA class I histocompatibility antigen, B-27 alpha chain

SCOPe Domain Sequences for d3b3ia1:

Sequence; same for both SEQRES and ATOM records:

>d3b3ia1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

Timeline for d3b3ia1:

• d3b3ia1 first appeared in SCOP 1.75
  
• d3b3ia1 appears in SCOPe 2.02
  
• d3b3ia1 appears in the current release, SCOPe 2.08