| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
| Protein Calmodulin [47516] (13 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [158477] (19 PDB entries) |
| Domain d3b32a_: 3b32 A: [154805] automated match to d1ak8a_ complexed with ca fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 3b32 (more details), 1.6 Å
SCOPe Domain Sequences for d3b32a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b32a_ a.39.1.5 (A:) Calmodulin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng
tidfpefltmmark
Timeline for d3b32a_: