SCOPe 2.05: Domain d3b2vh2: 3b2v H:122-221

Lineage for d3b2vh2 (3b2v H:122-221)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d3b2vh2: 3b2v H:122-221 [154803]
   Other proteins in same PDB: d3b2vh1
   automatically matched to d1ngzb2
   complexed with nag

Details for d3b2vh2

PDB Entry: 3b2v, 3.3 Å

PDB Description: crystal structure of the extracellular region of the epidermal growth factor receptor in complex with the fab fragment of imc-11f8

PDB Compounds: (H:) IMC-11F8 FAB Heavy chain

SCOPe Domain Sequences for d3b2vh2:

Sequence, based on SEQRES records:

>d3b2vh2 b.1.1.2 (H:122-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records):

>d3b2vh2 b.1.1.2 (H:122-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d3b2vh2:

• d3b2vh2 first appeared in SCOP 1.75
  
• d3b2vh2 appears in SCOPe 2.04
  
• d3b2vh2 appears in SCOPe 2.06
  
• d3b2vh2 appears in the current release, SCOPe 2.08