SCOPe 2.07: Domain d3b2vh1: 3b2v H:6-121

Lineage for d3b2vh1 (3b2v H:6-121)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (35 PDB entries)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)

8. Domain d3b2vh1: 3b2v H:6-121 [154802]
   Other proteins in same PDB: d3b2vh2, d3b2vh3
   automatically matched to d1deeb1
   complexed with bma, nag, ndg

Details for d3b2vh1

PDB Entry: 3b2v, 3.3 Å

PDB Description: crystal structure of the extracellular region of the epidermal growth factor receptor in complex with the fab fragment of imc-11f8

PDB Compounds: (H:) IMC-11F8 FAB Heavy chain

SCOPe Domain Sequences for d3b2vh1:

Sequence; same for both SEQRES and ATOM records:

>d3b2vh1 b.1.1.1 (H:6-121) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
esgpglvkpsqtlsltctvsggsissgdyywswirqppgkglewigyiyysgstdynpsl
ksrvtmsvdtsknqfslkvnsvtaadtavyycarvsifgvgtfdywgqgtlvtvss

Timeline for d3b2vh1:

• d3b2vh1 first appeared in SCOP 1.75
  
• d3b2vh1 appears in SCOPe 2.06
  
• d3b2vh1 appears in the current release, SCOPe 2.08