Class a: All alpha proteins [46456] (171 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (18 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (18 species) |
Species Human (Homo sapiens) [TaxId:9606] [46501] (95 PDB entries) |
Domain d2hbsh_: 2hbs H: [15480] Other proteins in same PDB: d2hbsa_, d2hbsc_, d2hbse_, d2hbsg_ complexed with hem; mutant |
PDB Entry: 2hbs (more details), 2.05 Å
SCOP Domain Sequences for d2hbsh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hbsh_ a.1.1.2 (H:) Hemoglobin, beta-chain {Human (Homo sapiens)} vhltpveksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk eftppvqaayqkvvagvanalahkyh
Timeline for d2hbsh_: