Lineage for d3b2uj2 (3b2u J:122-221)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1107361Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1107365Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 1107542Domain d3b2uj2: 3b2u J:122-221 [154785]
    Other proteins in same PDB: d3b2ua1, d3b2ua2, d3b2ub1, d3b2ub2, d3b2uc1, d3b2ue1, d3b2ue2, d3b2uf1, d3b2uh1, d3b2ui1, d3b2ui2, d3b2uj1, d3b2um1, d3b2um2, d3b2un1, d3b2up1, d3b2up2, d3b2uq1, d3b2us1, d3b2us2, d3b2ut1, d3b2uv1, d3b2uv2, d3b2uw1
    automatically matched to d1ngzb2
    complexed with nag, so4

Details for d3b2uj2

PDB Entry: 3b2u (more details), 2.58 Å

PDB Description: crystal structure of isolated domain iii of the extracellular region of the epidermal growth factor receptor in complex with the fab fragment of imc-11f8
PDB Compounds: (J:) IMC-11F8 FAB Heavy chain

SCOPe Domain Sequences for d3b2uj2:

Sequence, based on SEQRES records: (download)

>d3b2uj2 b.1.1.2 (J:122-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d3b2uj2 b.1.1.2 (J:122-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d3b2uj2:

Click to download the PDB-style file with coordinates for d3b2uj2.
(The format of our PDB-style files is described here.)

Timeline for d3b2uj2: