SCOP 1.59: Domain d2hbsd_: 2hbs D:

Lineage for d2hbsd_ (2hbs D:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)

6. Protein Hemoglobin, beta-chain [46500] (18 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (76 PDB entries)

8. Domain d2hbsd_: 2hbs D: [15478]
   Other proteins in same PDB: d2hbsa_, d2hbsc_, d2hbse_, d2hbsg_

Details for d2hbsd_

PDB Entry: 2hbs, 2.05 Å

PDB Description: the high resolution crystal structure of deoxyhemoglobin s

SCOP Domain Sequences for d2hbsd_:

Sequence; same for both SEQRES and ATOM records:

>d2hbsd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens)}
vhltpveksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d2hbsd_:

• d2hbsd_ first appeared (with stable ids) in SCOP 1.55
  
• d2hbsd_ appears in SCOP 1.57
  
• d2hbsd_ appears in SCOP 1.61
  
• d2hbsd_ appears in the current release, SCOPe 2.08