Lineage for d3b2ue1 (3b2u E:312-480)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 823992Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 824043Superfamily c.10.2: L domain-like [52058] (8 families) (S)
    less regular structure consisting of variable repeats
  5. 824097Family c.10.2.5: L domain [52071] (5 proteins)
  6. 824098Protein EGF receptor extracellular domain [82326] (1 species)
  7. 824099Species Human (Homo sapiens) [TaxId:9606] [82327] (6 PDB entries)
  8. 824102Domain d3b2ue1: 3b2u E:312-480 [154776]
    Other proteins in same PDB: d3b2ua2, d3b2ub2, d3b2uc1, d3b2uc2, d3b2ue2, d3b2uf1, d3b2uf2, d3b2uh1, d3b2uh2, d3b2ui2, d3b2uj1, d3b2uj2, d3b2um2, d3b2un1, d3b2un2, d3b2up2, d3b2uq1, d3b2uq2, d3b2us2, d3b2ut1, d3b2ut2, d3b2uv2, d3b2uw1, d3b2uw2
    automatically matched to d1ivoa2
    complexed with bma, man, nag, so4

Details for d3b2ue1

PDB Entry: 3b2u (more details), 2.58 Å

PDB Description: crystal structure of isolated domain iii of the extracellular region of the epidermal growth factor receptor in complex with the fab fragment of imc-11f8
PDB Compounds: (E:) Epidermal growth factor receptor

SCOP Domain Sequences for d3b2ue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b2ue1 c.10.2.5 (E:312-480) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
vcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldil
ktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrslke
isdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq

SCOP Domain Coordinates for d3b2ue1:

Click to download the PDB-style file with coordinates for d3b2ue1.
(The format of our PDB-style files is described here.)

Timeline for d3b2ue1: