Lineage for d2hbsb_ (2hbs B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 2300379Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2300506Species Human (Homo sapiens) [TaxId:9606] [46501] (249 PDB entries)
    Uniprot P68871
  8. 2300862Domain d2hbsb_: 2hbs B: [15477]
    Other proteins in same PDB: d2hbsa_, d2hbsc_, d2hbse_, d2hbsg_
    complexed with hem

Details for d2hbsb_

PDB Entry: 2hbs (more details), 2.05 Å

PDB Description: the high resolution crystal structure of deoxyhemoglobin s
PDB Compounds: (B:) hemoglobin s (deoxy), beta chain

SCOPe Domain Sequences for d2hbsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hbsb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
vhltpveksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d2hbsb_:

Click to download the PDB-style file with coordinates for d2hbsb_.
(The format of our PDB-style files is described here.)

Timeline for d2hbsb_: