SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3b2rb_ (3b2r B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2014926Family a.211.1.2: PDEase [48548] (7 protein domains)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2015121Protein cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx [101439] (1 species)
  7. 2015122Species Human (Homo sapiens) [TaxId:9606] [101440] (18 PDB entries)
    Uniprot O76074 534-860
  8. 2015136Domain d3b2rb_: 3b2r B: [154769]
    Other proteins in same PDB: d3b2ra3
    automated match to d1rkpa_
    complexed with vdn

Details for d3b2rb_

PDB Entry: 3b2r (more details), 2.07 Å

PDB Description: Crystal Structure of PDE5A1 catalytic domain in complex with Vardenafil
PDB Compounds: (B:) cGMP-specific 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d3b2rb_:

Sequence, based on SEQRES records: (download)

>d3b2rb_ a.211.1.2 (B:) cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx {Human (Homo sapiens) [TaxId: 9606]}
relqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlcr
wilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdldh
rgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlkiik
qailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpiqqr
iaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealthvse
dcfplldgcrknrqkwqalaeqq

Sequence, based on observed residues (ATOM records): (download)

>d3b2rb_ a.211.1.2 (B:) cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx {Human (Homo sapiens) [TaxId: 9606]}
relqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlcr
wilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdldh
rgchsimehhhfdqclmilnspgnqilsglsieeykttlkiikqailatdlalyikrrge
ffelirknqfnledphqkelflamlmtacdlsaitkpwpiqqriaelvateffdqkknki
psmqvgfidaiclqlyealthvsedcfplldgcrknrqkwqalaeqq

SCOPe Domain Coordinates for d3b2rb_:

Click to download the PDB-style file with coordinates for d3b2rb_.
(The format of our PDB-style files is described here.)

Timeline for d3b2rb_: