SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2ztia_ (2zti A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120781Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2120998Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 2120999Family c.51.4.1: ITPase (Ham1) [52973] (4 protein domains)
    Pfam PF01725
  6. 2121014Protein XTP pyrophosphatase [52974] (2 species)
  7. 2121020Species Pyrococcus horikoshii [TaxId:53953] [102470] (7 PDB entries)
    PH1917
  8. 2121027Domain d2ztia_: 2zti A: [154767]
    automated match to d1v7ra_
    complexed with mn

Details for d2ztia_

PDB Entry: 2zti (more details), 2.6 Å

PDB Description: Structures of dimeric nonstandard nucleotide triphosphate pyrophosphatase from Pyrococcus horikoshii OT3: functional significance of interprotomer conformational changes
PDB Compounds: (A:) ntpase

SCOPe Domain Sequences for d2ztia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ztia_ c.51.4.1 (A:) XTP pyrophosphatase {Pyrococcus horikoshii [TaxId: 53953]}
mkiffitsnpgkvrevanflgtfgieivqlkheypeiqaekledvvdfgiswlkgkvpep
fmiedsglfieslkgfpgvyssyvyrtiglegilklmegaedrrayfksvigfyidgkay
kfsgvtwgrisnekrgthgfgydpifipegsektfaemtieeknalshrgkalkaffewl
kvnl

SCOPe Domain Coordinates for d2ztia_:

Click to download the PDB-style file with coordinates for d2ztia_.
(The format of our PDB-style files is described here.)

Timeline for d2ztia_: