Lineage for d2zqoa1 (2zqo A:131-260)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2385272Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2385273Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 2385274Protein 29-kDa galactose-binding lectin [159148] (1 species)
    duplication: tadem repeat of two Ricin B-like domains
  7. 2385275Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [159149] (5 PDB entries)
    Uniprot O96048 131-260
  8. 2385276Domain d2zqoa1: 2zqo A:131-260 [154765]
    second domain only
    complexed with cd, imd, nga, po4

Details for d2zqoa1

PDB Entry: 2zqo (more details), 1.8 Å

PDB Description: Crystal structure of the earthworm R-type lectin C-half in complex with GalNAc
PDB Compounds: (A:) 29-kDa galactose-binding lectin

SCOPe Domain Sequences for d2zqoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zqoa1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
pkffyikselngkvldiegqnpapgskiitwdqkkgptavnqlwytdqqgvirsklndfa
idasheqietqpfdpnnpkrawivsgntiaqlsdrdivldiiksdkeagahicawkqhgg
pnqkfiiese

SCOPe Domain Coordinates for d2zqoa1:

Click to download the PDB-style file with coordinates for d2zqoa1.
(The format of our PDB-style files is described here.)

Timeline for d2zqoa1: