Lineage for d2zpya3 (2zpy A:3-87)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 853597Superfamily d.15.1: Ubiquitin-like [54236] (8 families) (S)
  5. 853959Family d.15.1.4: First domain of FERM [54256] (6 proteins)
  6. 853988Protein Radixin [54259] (1 species)
  7. 853989Species Mouse (Mus musculus) [TaxId:10090] [54260] (10 PDB entries)
  8. 853990Domain d2zpya3: 2zpy A:3-87 [154760]
    Other proteins in same PDB: d2zpya1, d2zpya2
    automatically matched to d1gc6a3

Details for d2zpya3

PDB Entry: 2zpy (more details), 2.1 Å

PDB Description: Crystal structure of the mouse radxin FERM domain complexed with the mouse CD44 cytoplasmic peptide
PDB Compounds: (A:) Radixin

SCOP Domain Sequences for d2zpya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zpya3 d.15.1.4 (A:3-87) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
kpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkln
kkvtqqdvkkenplqfkfrakffpe

SCOP Domain Coordinates for d2zpya3:

Click to download the PDB-style file with coordinates for d2zpya3.
(The format of our PDB-style files is described here.)

Timeline for d2zpya3: