Lineage for d1buwd_ (1buw D:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 287Protein Hemoglobin, beta-chain [46500] (15 species)
  7. 329Species Human (Homo sapiens) [TaxId:9606] [46501] (71 PDB entries)
  8. 390Domain d1buwd_: 1buw D: [15476]
    Other proteins in same PDB: d1buwa_, d1buwc_

Details for d1buwd_

PDB Entry: 1buw (more details), 1.9 Å

PDB Description: crystal structure of s-nitroso-nitrosyl human hemoglobin a

SCOP Domain Sequences for d1buwd_:

Sequence, based on SEQRES records: (download)

>d1buwd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens)}
vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhxdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahk

Sequence, based on observed residues (ATOM records): (download)

>d1buwd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens)}
vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhdklhvdpenfrllgnvlvcvlahhfgke
ftppvqaayqkvvagvanalahk

SCOP Domain Coordinates for d1buwd_:

Click to download the PDB-style file with coordinates for d1buwd_.
(The format of our PDB-style files is described here.)

Timeline for d1buwd_: