Lineage for d2zpya2 (2zpy A:199-297)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2413059Family b.55.1.5: Third domain of FERM [50776] (8 proteins)
  6. 2413089Protein Radixin [50779] (1 species)
  7. 2413090Species Mouse (Mus musculus) [TaxId:10090] [50780] (9 PDB entries)
  8. 2413091Domain d2zpya2: 2zpy A:199-297 [154759]
    Other proteins in same PDB: d2zpya1, d2zpya3
    automatically matched to d1gc6a2

Details for d2zpya2

PDB Entry: 2zpy (more details), 2.1 Å

PDB Description: Crystal structure of the mouse radxin FERM domain complexed with the mouse CD44 cytoplasmic peptide
PDB Compounds: (A:) Radixin

SCOPe Domain Sequences for d2zpya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zpya2 b.55.1.5 (A:199-297) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp

SCOPe Domain Coordinates for d2zpya2:

Click to download the PDB-style file with coordinates for d2zpya2.
(The format of our PDB-style files is described here.)

Timeline for d2zpya2: