| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.2: Second domain of FERM [47031] (1 family) ![]() |
| Family a.11.2.1: Second domain of FERM [47032] (8 proteins) |
| Protein Radixin [47035] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [47036] (10 PDB entries) |
| Domain d2zpya1: 2zpy A:88-198 [154758] Other proteins in same PDB: d2zpya2, d2zpya3 automatically matched to d1gc6a1 |
PDB Entry: 2zpy (more details), 2.1 Å
SCOP Domain Sequences for d2zpya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zpya1 a.11.2.1 (A:88-198) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
dvseeliqeitqrlfflqvkeailndeiycppetavllasyavqakygdynkeihkpgyl
andrllpqrvleqhkltkeqweeriqnwheehrgmlredsmmeylkiaqdl
Timeline for d2zpya1: