Lineage for d2zpya1 (2zpy A:88-198)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764491Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 764506Superfamily a.11.2: Second domain of FERM [47031] (1 family) (S)
  5. 764507Family a.11.2.1: Second domain of FERM [47032] (8 proteins)
  6. 764536Protein Radixin [47035] (1 species)
  7. 764537Species Mouse (Mus musculus) [TaxId:10090] [47036] (10 PDB entries)
  8. 764538Domain d2zpya1: 2zpy A:88-198 [154758]
    Other proteins in same PDB: d2zpya2, d2zpya3
    automatically matched to d1gc6a1

Details for d2zpya1

PDB Entry: 2zpy (more details), 2.1 Å

PDB Description: Crystal structure of the mouse radxin FERM domain complexed with the mouse CD44 cytoplasmic peptide
PDB Compounds: (A:) Radixin

SCOP Domain Sequences for d2zpya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zpya1 a.11.2.1 (A:88-198) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
dvseeliqeitqrlfflqvkeailndeiycppetavllasyavqakygdynkeihkpgyl
andrllpqrvleqhkltkeqweeriqnwheehrgmlredsmmeylkiaqdl

SCOP Domain Coordinates for d2zpya1:

Click to download the PDB-style file with coordinates for d2zpya1.
(The format of our PDB-style files is described here.)

Timeline for d2zpya1: