SCOP 1.75: Domain d2zp0l2: 2zp0 L:91-140

Lineage for d2zp0l2 (2zp0 L:91-140)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (22 proteins)

6. Protein Factor IX (IXa) [57198] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57199] (5 PDB entries)

8. Domain d2zp0l2: 2zp0 L:91-140 [154746]
   Other proteins in same PDB: d2zp0h1, d2zp0l3, d2zp0t1, d2zp0t2
   automatically matched to d1pfxl2
   complexed with bgc, ca, fuc, pi0

Details for d2zp0l2

PDB Entry: 2zp0, 2.7 Å

PDB Description: human factor viia-tissue factor complexed with benzylsulfonamide-d- ile-gln-p-aminobenzamidine

PDB Compounds: (L:) Factor VII light chain

SCOP Domain Sequences for d2zp0l2:

Sequence; same for both SEQRES and ATOM records:

>d2zp0l2 g.3.11.1 (L:91-140) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}
cvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipi

Timeline for d2zp0l2:

• d2zp0l2 is new in SCOP 1.75
  
• d2zp0l2 appears in SCOPe 2.01
  
• d2zp0l2 appears in the current release, SCOPe 2.08