Lineage for d2zp0l1 (2zp0 L:49-86)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961206Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1961207Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1961216Protein Coagulation factor VIIa [57201] (1 species)
  7. 1961217Species Human (Homo sapiens) [TaxId:9606] [57202] (56 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 1961272Domain d2zp0l1: 2zp0 L:49-86 [154745]
    Other proteins in same PDB: d2zp0h_, d2zp0l3, d2zp0t1, d2zp0t2
    automated match to d1danl1
    complexed with bgc, ca, fuc, pi0

Details for d2zp0l1

PDB Entry: 2zp0 (more details), 2.7 Å

PDB Description: human factor viia-tissue factor complexed with benzylsulfonamide-d- ile-gln-p-aminobenzamidine
PDB Compounds: (L:) Factor VII light chain

SCOPe Domain Sequences for d2zp0l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zp0l1 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOPe Domain Coordinates for d2zp0l1:

Click to download the PDB-style file with coordinates for d2zp0l1.
(The format of our PDB-style files is described here.)

Timeline for d2zp0l1: