Class g: Small proteins [56992] (92 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Coagulation factor VIIa [57201] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57202] (56 PDB entries) Uniprot P08709 108-202 ! Uniprot P08709 107-202 |
Domain d2zp0l1: 2zp0 L:49-86 [154745] Other proteins in same PDB: d2zp0h_, d2zp0l3, d2zp0t1, d2zp0t2 automated match to d1danl1 complexed with bgc, ca, fuc, pi0 |
PDB Entry: 2zp0 (more details), 2.7 Å
SCOPe Domain Sequences for d2zp0l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zp0l1 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} qcasspcqnggsckdqlqsyicfclpafegrncethkd
Timeline for d2zp0l1: