![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (7 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (22 proteins) |
![]() | Protein Factor IX (IXa) [57198] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57199] (5 PDB entries) |
![]() | Domain d2zp0l1: 2zp0 L:46-82 [154745] Other proteins in same PDB: d2zp0h1, d2zp0l3, d2zp0t1, d2zp0t2 automatically matched to d1pfxl1 complexed with bgc, ca, fuc, pi0 |
PDB Entry: 2zp0 (more details), 2.7 Å
SCOP Domain Sequences for d2zp0l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zp0l1 g.3.11.1 (L:46-82) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} dgdqcasspcqnggsckdqlqsyicfclpafegrnce
Timeline for d2zp0l1: