SCOPe 2.05: Domain d2zoza1: 2zoz A:3-73

Lineage for d2zoza1 (2zoz A:3-73)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Transcriptional regulator Cgl2612 [140181] (1 species)

7. Species Corynebacterium glutamicum [TaxId:1718] [140182] (3 PDB entries)
   Uniprot Q8NMG3 1-174

8. Domain d2zoza1: 2zoz A:3-73 [154740]
   Other proteins in same PDB: d2zoza2, d2zozb2
   complexed with et, gol, so4

Details for d2zoza1

PDB Entry: 2zoz, 1.95 Å

PDB Description: Crystal structure of the ethidium-bound form of the multi-drug binding transcriptional repressor CgmR

PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d2zoza1:

Sequence; same for both SEQRES and ATOM records:

>d2zoza1 a.4.1.9 (A:3-73) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]}
tskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhelladd
wdkelrditrd

Timeline for d2zoza1:

• d2zoza1 first appeared in SCOP 1.75
  
• d2zoza1 appears in SCOPe 2.04
  
• d2zoza1 appears in SCOPe 2.06
  
• d2zoza1 appears in the current release, SCOPe 2.08