SCOP 1.75: Domain d2zold1: 2zol D:2-99

Lineage for d2zold1 (2zol D:2-99)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (91 PDB entries)
   Uniprot P01887

8. Domain d2zold1: 2zol D:2-99 [154739]
   Other proteins in same PDB: d2zola1, d2zola2, d2zolc1, d2zolc2
   automatically matched to d1bz9b_
   complexed with aba, so4; mutant

Details for d2zold1

PDB Entry: 2zol, 2.7 Å

PDB Description: crystal structure of h-2db in complex with the w513s variant of jhmv epitope s510

PDB Compounds: (D:) Beta-2-microglobulin

SCOP Domain Sequences for d2zold1:

Sequence; same for both SEQRES and ATOM records:

>d2zold1 b.1.1.2 (D:2-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws
fyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d2zold1:

• d2zold1 is new in SCOP 1.75
  
• d2zold1 is called d2zold_ in SCOPe 2.01
  
• d2zold1 appears in the current release, SCOPe 2.08, called d2zold_