Lineage for d2zolc1 (2zol C:182-274)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 932656Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 932877Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
    Uniprot P01901 22-299
  8. 932984Domain d2zolc1: 2zol C:182-274 [154737]
    Other proteins in same PDB: d2zola2, d2zolb_, d2zolc2, d2zold_
    automatically matched to d1ddha1
    complexed with so4

Details for d2zolc1

PDB Entry: 2zol (more details), 2.7 Å

PDB Description: crystal structure of h-2db in complex with the w513s variant of jhmv epitope s510
PDB Compounds: (C:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d2zolc1:

Sequence, based on SEQRES records: (download)

>d2zolc1 b.1.1.2 (C:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

Sequence, based on observed residues (ATOM records): (download)

>d2zolc1 b.1.1.2 (C:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwmelvetrpagdgtfqkwasvvvqn
ytcrvyheglpepltlrw

SCOPe Domain Coordinates for d2zolc1:

Click to download the PDB-style file with coordinates for d2zolc1.
(The format of our PDB-style files is described here.)

Timeline for d2zolc1: