| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Class I MHC, alpha-3 domain [88604] (4 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries) Uniprot P01901 22-299 |
| Domain d2zolc1: 2zol C:182-274 [154737] Other proteins in same PDB: d2zola2, d2zolb1, d2zolc2, d2zold1 automatically matched to d1ddha1 complexed with aba, so4; mutant |
PDB Entry: 2zol (more details), 2.7 Å
SCOP Domain Sequences for d2zolc1:
Sequence, based on SEQRES records: (download)
>d2zolc1 b.1.1.2 (C:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw
>d2zolc1 b.1.1.2 (C:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwmelvetrpagdgtfqkwasvvvqn
ytcrvyheglpepltlrw
Timeline for d2zolc1:
View in 3DDomains from other chains: (mouse over for more information) d2zola1, d2zola2, d2zolb1, d2zold1 |