![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class I MHC, alpha-3 domain [88604] (4 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries) Uniprot P01901 22-299 |
![]() | Domain d2zolc1: 2zol C:182-274 [154737] Other proteins in same PDB: d2zola2, d2zolb_, d2zolc2, d2zold_ automatically matched to d1ddha1 complexed with so4 |
PDB Entry: 2zol (more details), 2.7 Å
SCOPe Domain Sequences for d2zolc1:
Sequence, based on SEQRES records: (download)
>d2zolc1 b.1.1.2 (C:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf qkwasvvvplgkeqnytcrvyheglpepltlrw
>d2zolc1 b.1.1.2 (C:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvthhprskgevtlrcwalgfypaditltwmelvetrpagdgtfqkwasvvvqn ytcrvyheglpepltlrw
Timeline for d2zolc1:
![]() Domains from other chains: (mouse over for more information) d2zola1, d2zola2, d2zolb_, d2zold_ |