Lineage for d2zola2 (2zol A:3-180)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1641840Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1642202Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (20 PDB entries)
  8. 1642232Domain d2zola2: 2zol A:3-180 [154735]
    Other proteins in same PDB: d2zola1, d2zolb_, d2zolc1, d2zold_
    automatically matched to d1ddha2
    complexed with so4

Details for d2zola2

PDB Entry: 2zol (more details), 2.7 Å

PDB Description: crystal structure of h-2db in complex with the w513s variant of jhmv epitope s510
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d2zola2:

Sequence, based on SEQRES records: (download)

>d2zola2 d.19.1.1 (A:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywer
etqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrd
yialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll

Sequence, based on observed residues (ATOM records): (download)

>d2zola2 d.19.1.1 (A:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hsmryfetavsrpgepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyweret
qkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrdyi
alnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll

SCOPe Domain Coordinates for d2zola2:

Click to download the PDB-style file with coordinates for d2zola2.
(The format of our PDB-style files is described here.)

Timeline for d2zola2: