SCOPe 2.01: Domain d2zoke1: 2zok E:182-274

Lineage for d2zoke1 (2zok E:182-274)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
   Uniprot P01901 22-299

8. Domain d2zoke1: 2zok E:182-274 [154728]
   Other proteins in same PDB: d2zoka2, d2zokb_, d2zokc2, d2zokd_, d2zoke2, d2zokf_, d2zokg2, d2zokh_
   automatically matched to d1ddha1
   complexed with gol, so4

Details for d2zoke1

PDB Entry: 2zok, 2.1 Å

PDB Description: crystal structure of h-2db in complex with jhmv epitope s510

PDB Compounds: (E:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d2zoke1:

Sequence, based on SEQRES records:

>d2zoke1 b.1.1.2 (E:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

Sequence, based on observed residues (ATOM records):

>d2zoke1 b.1.1.2 (E:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprtlrcwalgfypaditltwlvetrpagdgtfqkwasvvvqnytcrvyh
eglpepltlrw

Timeline for d2zoke1:

• d2zoke1 first appeared in SCOP 1.75
  
• d2zoke1 appears in SCOPe 2.02
  
• d2zoke1 appears in the current release, SCOPe 2.08