![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Class I MHC, alpha-3 domain [88604] (4 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries) Uniprot P01901 22-299 |
![]() | Domain d2zokc1: 2zok C:182-274 [154725] Other proteins in same PDB: d2zoka2, d2zokb1, d2zokc2, d2zokd1, d2zoke2, d2zokf1, d2zokg2, d2zokh1 automatically matched to d1ddha1 complexed with aba, gol, so4 |
PDB Entry: 2zok (more details), 2.1 Å
SCOP Domain Sequences for d2zokc1:
Sequence, based on SEQRES records: (download)
>d2zokc1 b.1.1.2 (C:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf qkwasvvvplgkeqnytcrvyheglpepltlrw
>d2zokc1 b.1.1.2 (C:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvthhprkevtlrcwalgfypaditltwqldmelvetrpagdgtfqkwasvvvp leqnytcrvyheglpepltlrw
Timeline for d2zokc1: