Lineage for d2zoka2 (2zok A:3-180)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182691Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2183074Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (23 PDB entries)
  8. 2183082Domain d2zoka2: 2zok A:3-180 [154723]
    Other proteins in same PDB: d2zoka1, d2zoka3, d2zokb_, d2zokc1, d2zokd_, d2zoke1, d2zoke3, d2zokf_, d2zokg1, d2zokh_
    automatically matched to d1ddha2
    complexed with gol, so4

Details for d2zoka2

PDB Entry: 2zok (more details), 2.1 Å

PDB Description: crystal structure of h-2db in complex with jhmv epitope s510
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d2zoka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zoka2 d.19.1.1 (A:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywer
etqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrd
yialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll

SCOPe Domain Coordinates for d2zoka2:

Click to download the PDB-style file with coordinates for d2zoka2.
(The format of our PDB-style files is described here.)

Timeline for d2zoka2: