SCOPe 2.02: Domain d2zoka2: 2zok A:3-180

Lineage for d2zoka2 (2zok A:3-180)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (21 PDB entries)

8. Domain d2zoka2: 2zok A:3-180 [154723]
   Other proteins in same PDB: d2zoka1, d2zokb_, d2zokc1, d2zokd_, d2zoke1, d2zokf_, d2zokg1, d2zokh_
   automatically matched to d1ddha2
   complexed with gol, so4

Details for d2zoka2

PDB Entry: 2zok, 2.1 Å

PDB Description: crystal structure of h-2db in complex with jhmv epitope s510

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d2zoka2:

Sequence; same for both SEQRES and ATOM records:

>d2zoka2 d.19.1.1 (A:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywer
etqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrd
yialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll

Timeline for d2zoka2:

• d2zoka2 first appeared in SCOP 1.75
  
• d2zoka2 appears in SCOPe 2.01
  
• d2zoka2 appears in SCOPe 2.03
  
• d2zoka2 appears in the current release, SCOPe 2.08