Lineage for d2zoka1 (2zok A:182-274)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 932656Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 932877Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
    Uniprot P01901 22-299
  8. 932911Domain d2zoka1: 2zok A:182-274 [154722]
    Other proteins in same PDB: d2zoka2, d2zokb_, d2zokc2, d2zokd_, d2zoke2, d2zokf_, d2zokg2, d2zokh_
    automatically matched to d1ddha1
    complexed with gol, so4

Details for d2zoka1

PDB Entry: 2zok (more details), 2.1 Å

PDB Description: crystal structure of h-2db in complex with jhmv epitope s510
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d2zoka1:

Sequence, based on SEQRES records: (download)

>d2zoka1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

Sequence, based on observed residues (ATOM records): (download)

>d2zoka1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhtlrcwalgfypaditltwmelvetrpagdgtfqkwasvvvqnycrvyhe
glpepltlrw

SCOPe Domain Coordinates for d2zoka1:

Click to download the PDB-style file with coordinates for d2zoka1.
(The format of our PDB-style files is described here.)

Timeline for d2zoka1: