Lineage for d2zoab1 (2zoa B:1-271)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 876798Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 876799Superfamily d.159.1: Metallo-dependent phosphatases [56300] (12 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 877000Family d.159.1.11: GpdQ-like [160875] (2 proteins)
    part of Pfam PF00149
  6. 877001Protein Glycerophosphodiesterase GpdQ [160878] (1 species)
  7. 877002Species Enterobacter aerogenes [TaxId:548] [160879] (5 PDB entries)
    Uniprot Q6XBH1 1-271
  8. 877012Domain d2zoab1: 2zoa B:1-271 [154717]
    automatically matched to 2ZO9 B:1-271
    complexed with fe2, mli

Details for d2zoab1

PDB Entry: 2zoa (more details), 2.4 Å

PDB Description: malonate-bound structure of the glycerophosphodiesterase from enterobacter aerogenes (gpdq) collected at 1.280 angstrom
PDB Compounds: (B:) Phosphohydrolase

SCOP Domain Sequences for d2zoab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zoab1 d.159.1.11 (B:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]}
mllahisdthfrsrgeklygfidvnaanadvvsqlnalrerpdavvvsgdivncgrpeey
qvarqilgslnyplylipgnhddkalfleylqplcpqlgsdannmrcavddfatrllfid
ssragtskgwltdetiswleaqlfeggdkpatifmhhpplplgnaqmdpiacenghrlla
lverfpsltrifcghnhsltmtqyrqalistlpgtvhqvpychadtdpyydlspasclmh
rqvgeqwvsyqhslahyagpwlydeniscpt

SCOP Domain Coordinates for d2zoab1:

Click to download the PDB-style file with coordinates for d2zoab1.
(The format of our PDB-style files is described here.)

Timeline for d2zoab1: