| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
| Family d.159.1.11: GpdQ-like [160875] (2 proteins) part of Pfam PF00149 |
| Protein Glycerophosphodiesterase GpdQ [160878] (1 species) |
| Species Enterobacter aerogenes [TaxId:548] [160879] (5 PDB entries) Uniprot Q6XBH1 1-271 |
| Domain d2zo9c_: 2zo9 C: [154715] automated match to d2dxla1 complexed with fe2, mli |
PDB Entry: 2zo9 (more details), 2.2 Å
SCOPe Domain Sequences for d2zo9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zo9c_ d.159.1.11 (C:) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]}
mllahisdthfrsrgeklygfidvnaanadvvsqlnalrerpdavvvsgdivncgrpeey
qvarqilgslnyplylipgnhddkalfleylqplcpqlgsdannmrcavddfatrllfid
ssragtskgwltdetiswleaqlfeggdkpatifmhhpplplgnaqmdpiacenghrlla
lverfpsltrifcghnhsltmtqyrqalistlpgtvhqvpychadtdpyydlspasclmh
rqvgeqwvsyqhslahyagpwlydeniscpt
Timeline for d2zo9c_: