Lineage for d2zo9c_ (2zo9 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998432Family d.159.1.11: GpdQ-like [160875] (2 proteins)
    part of Pfam PF00149
  6. 2998433Protein Glycerophosphodiesterase GpdQ [160878] (1 species)
  7. 2998434Species Enterobacter aerogenes [TaxId:548] [160879] (5 PDB entries)
    Uniprot Q6XBH1 1-271
  8. 2998442Domain d2zo9c_: 2zo9 C: [154715]
    automated match to d2dxla1
    complexed with fe2, mli

Details for d2zo9c_

PDB Entry: 2zo9 (more details), 2.2 Å

PDB Description: Malonate-bound structure of the glycerophosphodiesterase from Enterobacter aerogenes (GpdQ) and characterization of the native Fe2+ metal ion preference
PDB Compounds: (C:) Phosphohydrolase

SCOPe Domain Sequences for d2zo9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zo9c_ d.159.1.11 (C:) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]}
mllahisdthfrsrgeklygfidvnaanadvvsqlnalrerpdavvvsgdivncgrpeey
qvarqilgslnyplylipgnhddkalfleylqplcpqlgsdannmrcavddfatrllfid
ssragtskgwltdetiswleaqlfeggdkpatifmhhpplplgnaqmdpiacenghrlla
lverfpsltrifcghnhsltmtqyrqalistlpgtvhqvpychadtdpyydlspasclmh
rqvgeqwvsyqhslahyagpwlydeniscpt

SCOPe Domain Coordinates for d2zo9c_:

Click to download the PDB-style file with coordinates for d2zo9c_.
(The format of our PDB-style files is described here.)

Timeline for d2zo9c_: