SCOP 1.75: Domain d2zo9b1: 2zo9 B:1-271

Lineage for d2zo9b1 (2zo9 B:1-271)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (12 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.11: GpdQ-like [160875] (2 proteins)
   part of Pfam PF00149

6. Protein Glycerophosphodiesterase GpdQ [160878] (1 species)

7. Species Enterobacter aerogenes [TaxId:548] [160879] (5 PDB entries)
   Uniprot Q6XBH1 1-271

8. Domain d2zo9b1: 2zo9 B:1-271 [154714]
   complexed with fe2, mli

Details for d2zo9b1

PDB Entry: 2zo9, 2.2 Å

PDB Description: Malonate-bound structure of the glycerophosphodiesterase from Enterobacter aerogenes (GpdQ) and characterization of the native Fe2+ metal ion preference

PDB Compounds: (B:) Phosphohydrolase

SCOP Domain Sequences for d2zo9b1:

Sequence; same for both SEQRES and ATOM records:

>d2zo9b1 d.159.1.11 (B:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]}
mllahisdthfrsrgeklygfidvnaanadvvsqlnalrerpdavvvsgdivncgrpeey
qvarqilgslnyplylipgnhddkalfleylqplcpqlgsdannmrcavddfatrllfid
ssragtskgwltdetiswleaqlfeggdkpatifmhhpplplgnaqmdpiacenghrlla
lverfpsltrifcghnhsltmtqyrqalistlpgtvhqvpychadtdpyydlspasclmh
rqvgeqwvsyqhslahyagpwlydeniscpt

Timeline for d2zo9b1:

• d2zo9b1 is new in SCOP 1.75
  
• d2zo9b1 appears in SCOPe 2.01
  
• d2zo9b1 appears in the current release, SCOPe 2.08