Lineage for d2zo2b2 (2zo2 B:419-625)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2076966Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2076967Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 2077175Family b.122.1.12: SRA domain-like [159368] (2 protein domains)
    Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA
  6. 2077176Protein E3 ubiquitin-protein ligase UHRF1 [159369] (2 species)
  7. 2077185Species Mouse (Mus musculus) [TaxId:10090] [159371] (10 PDB entries)
    Uniprot Q8VDF2 405-613! Uniprot Q8VDF2 418-625
  8. 2077201Domain d2zo2b2: 2zo2 B:419-625 [154713]
    Other proteins in same PDB: d2zo2b3
    automated match to d3fdea_
    protein/DNA complex; complexed with po4

Details for d2zo2b2

PDB Entry: 2zo2 (more details), 3.09 Å

PDB Description: Mouse NP95 SRA domain non-specific DNA complex
PDB Compounds: (B:) E3 ubiquitin-protein ligase UHRF1

SCOPe Domain Sequences for d2zo2b2:

Sequence, based on SEQRES records: (download)

>d2zo2b2 b.122.1.12 (B:419-625) E3 ubiquitin-protein ligase UHRF1 {Mouse (Mus musculus) [TaxId: 10090]}
panhfgpipgvpvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyeddvdng
nyftytgsggrdlsgnkrtagqssdqkltnnnralalnchspinekgaeaedwrqgkpvr
vvrnmkggkhskyapaegnrydgiykvvkywpergksgflvwryllrrddtepepwtreg
kdrtrqlgltmqypegylealankeks

Sequence, based on observed residues (ATOM records): (download)

>d2zo2b2 b.122.1.12 (B:419-625) E3 ubiquitin-protein ligase UHRF1 {Mouse (Mus musculus) [TaxId: 10090]}
panhfgpipgvpvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyeddvdng
nyftytgsggrdgqssdqkltnnnralalnchspinekgaeaedwrqgkpvrvvrnmkgg
khskyapaegnrydgiykvvkywpergksgflvwryllrrddtepepwtregkdrtrqlg
ltmqypegylealankeks

SCOPe Domain Coordinates for d2zo2b2:

Click to download the PDB-style file with coordinates for d2zo2b2.
(The format of our PDB-style files is described here.)

Timeline for d2zo2b2: