Lineage for d2znvb_ (2znv B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2539528Protein automated matches [190118] (17 species)
    not a true protein
  7. 2539783Species Mouse (Mus musculus) [TaxId:10090] [187278] (3 PDB entries)
  8. 2539784Domain d2znvb_: 2znv B: [154707]
    Other proteins in same PDB: d2znva_, d2znvc_, d2znvd_, d2znvf_
    automated match to d1aara_
    complexed with edo, zn

Details for d2znvb_

PDB Entry: 2znv (more details), 1.6 Å

PDB Description: crystal structure of human amsh-lp dub domain in complex with lys63- linked ubiquitin dimer
PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d2znvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2znvb_ d.15.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqrestlhlvlrlrgg

SCOPe Domain Coordinates for d2znvb_:

Click to download the PDB-style file with coordinates for d2znvb_.
(The format of our PDB-style files is described here.)

Timeline for d2znvb_: