| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.1: Legume lectins [49900] (5 proteins) |
| Protein Legume lectin [49904] (23 species) |
| Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (13 PDB entries) |
| Domain d2zmnd_: 2zmn D: [154704] automated match to d1wbfa_ complexed with ca, mn |
PDB Entry: 2zmn (more details), 2.9 Å
SCOPe Domain Sequences for d2zmnd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zmnd_ b.29.1.1 (D:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
Timeline for d2zmnd_: