SCOPe 2.08: Domain d2zmkb_: 2zmk B:

Lineage for d2zmkb_ (2zmk B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (13 PDB entries)

8. Domain d2zmkb_: 2zmk B: [154694]
   automated match to d1wbfa_
   complexed with bma, ca, mn, nag

Details for d2zmkb_

PDB Entry: 2zmk, 2.5 Å

PDB Description: crystl structure of basic winged bean lectin in complex with gal- alpha-1,4-gal-beta-ethylene

PDB Compounds: (B:) Basic agglutinin

SCOPe Domain Sequences for d2zmkb_:

Sequence; same for both SEQRES and ATOM records:

>d2zmkb_ b.29.1.1 (B:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

Timeline for d2zmkb_:

• d2zmkb_ first appeared in SCOP 1.75, called d2zmkb1
  
• d2zmkb_ appears in SCOPe 2.07