Lineage for d2zmka_ (2zmk A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1307105Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1307253Protein Legume lectin [49904] (23 species)
  7. 1307559Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (13 PDB entries)
  8. 1307586Domain d2zmka_: 2zmk A: [154693]
    automated match to d1wbfa_
    complexed with bma, ca, ehn, mn, nag

Details for d2zmka_

PDB Entry: 2zmk (more details), 2.5 Å

PDB Description: crystl structure of basic winged bean lectin in complex with gal- alpha-1,4-gal-beta-ethylene
PDB Compounds: (A:) Basic agglutinin

SCOPe Domain Sequences for d2zmka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zmka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

SCOPe Domain Coordinates for d2zmka_:

Click to download the PDB-style file with coordinates for d2zmka_.
(The format of our PDB-style files is described here.)

Timeline for d2zmka_: