Lineage for d2zmka_ (2zmk A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2373041Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2373210Protein Legume lectin [49904] (23 species)
  7. 2373519Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (13 PDB entries)
  8. 2373554Domain d2zmka_: 2zmk A: [154693]
    automated match to d1wbfa_
    complexed with bma, ca, mn, nag

Details for d2zmka_

PDB Entry: 2zmk (more details), 2.5 Å

PDB Description: Crystl structure of Basic Winged bean lectin in complex with Gal-alpha-1,4-Gal-Beta-Ethylene
PDB Compounds: (A:) Basic agglutinin

SCOPe Domain Sequences for d2zmka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zmka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

SCOPe Domain Coordinates for d2zmka_:

Click to download the PDB-style file with coordinates for d2zmka_.
(The format of our PDB-style files is described here.)

Timeline for d2zmka_: