Lineage for d2zlxd_ (2zlx D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1977443Protein Hemoglobin, beta-chain [46500] (25 species)
  7. 1977542Species Horse (Equus caballus) [TaxId:9796] [46504] (17 PDB entries)
  8. 1977561Domain d2zlxd_: 2zlx D: [154681]
    Other proteins in same PDB: d2zlxa_, d2zlxc_
    automated match to d1g0bb_
    complexed with hem

Details for d2zlxd_

PDB Entry: 2zlx (more details), 2.8 Å

PDB Description: horse methemoglobin high salt, ph 7.0 (66% relative humidity)
PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d2zlxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zlxd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

SCOPe Domain Coordinates for d2zlxd_:

Click to download the PDB-style file with coordinates for d2zlxd_.
(The format of our PDB-style files is described here.)

Timeline for d2zlxd_: