SCOP 1.75: Domain d2zlwc1: 2zlw C:1-141

Lineage for d2zlwc1 (2zlw C:1-141)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (20 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46488] (14 PDB entries)

8. Domain d2zlwc1: 2zlw C:1-141 [154676]
   Other proteins in same PDB: d2zlwb1, d2zlwd1
   automatically matched to d1g0ba_
   complexed with hem

Details for d2zlwc1

PDB Entry: 2zlw, 2.9 Å

PDB Description: horse methemoglobin high salt, ph 7.0 (75% relative humidity)

PDB Compounds: (C:) Hemoglobin subunit alpha

SCOP Domain Sequences for d2zlwc1:

Sequence; same for both SEQRES and ATOM records:

>d2zlwc1 a.1.1.2 (C:1-141) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

Timeline for d2zlwc1:

• d2zlwc1 is new in SCOP 1.75
  
• d2zlwc1 is called d2zlwc_ in SCOPe 2.01
  
• d2zlwc1 appears in the current release, SCOPe 2.08, called d2zlwc_