Lineage for d2zlwc1 (2zlw C:1-141)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 758539Protein Hemoglobin, alpha-chain [46486] (20 species)
  7. 758609Species Horse (Equus caballus) [TaxId:9796] [46488] (14 PDB entries)
  8. 758627Domain d2zlwc1: 2zlw C:1-141 [154676]
    Other proteins in same PDB: d2zlwb1, d2zlwd1
    automatically matched to d1g0ba_
    complexed with hem

Details for d2zlwc1

PDB Entry: 2zlw (more details), 2.9 Å

PDB Description: Horse methemoglobin high salt, pH 7.0 (75% relative humidity)
PDB Compounds: (C:) Hemoglobin subunit alpha

SCOP Domain Sequences for d2zlwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zlwc1 a.1.1.2 (C:1-141) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

SCOP Domain Coordinates for d2zlwc1:

Click to download the PDB-style file with coordinates for d2zlwc1.
(The format of our PDB-style files is described here.)

Timeline for d2zlwc1: