Class a: All alpha proteins [46456] (285 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (23 species) |
Species Horse (Equus caballus) [TaxId:9796] [46488] (16 PDB entries) |
Domain d2zlva_: 2zlv A: [154672] Other proteins in same PDB: d2zlvb_ automated match to d1g0ba_ complexed with hem |
PDB Entry: 2zlv (more details), 2 Å
SCOPe Domain Sequences for d2zlva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zlva_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]} vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa vhasldkflssvstvltskyr
Timeline for d2zlva_: