Lineage for d2zlva_ (2zlv A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686340Species Horse (Equus caballus) [TaxId:9796] [46488] (19 PDB entries)
  8. 2686354Domain d2zlva_: 2zlv A: [154672]
    Other proteins in same PDB: d2zlvb_
    automated match to d1g0ba_
    complexed with hem

Details for d2zlva_

PDB Entry: 2zlv (more details), 2 Å

PDB Description: horse methemoglobin high salt, ph 7.0 (79% relative humidity)
PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d2zlva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zlva_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

SCOPe Domain Coordinates for d2zlva_:

Click to download the PDB-style file with coordinates for d2zlva_.
(The format of our PDB-style files is described here.)

Timeline for d2zlva_: