SCOPe 2.06: Domain d2zlub_: 2zlu B:

Lineage for d2zlub_ (2zlu B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (25 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46504] (17 PDB entries)

8. Domain d2zlub_: 2zlu B: [154671]
   Other proteins in same PDB: d2zlua_
   automated match to d1g0bb_
   complexed with hem

Details for d2zlub_

PDB Entry: 2zlu, 2 Å

PDB Description: horse methemoglobin high salt, ph 7.0 (88% relative humidity)

PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d2zlub_:

Sequence; same for both SEQRES and ATOM records:

>d2zlub_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahky

Timeline for d2zlub_:

• d2zlub_ first appeared in SCOP 1.75, called d2zlub1
  
• d2zlub_ appears in SCOPe 2.05
  
• d2zlub_ appears in SCOPe 2.07
  
• d2zlub_ appears in the current release, SCOPe 2.08