Lineage for d2zlua_ (2zlu A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 902058Protein Hemoglobin, alpha-chain [46486] (22 species)
  7. 902146Species Horse (Equus caballus) [TaxId:9796] [46488] (14 PDB entries)
  8. 902152Domain d2zlua_: 2zlu A: [154670]
    Other proteins in same PDB: d2zlub_
    automated match to d1g0ba_
    complexed with hem

Details for d2zlua_

PDB Entry: 2zlu (more details), 2 Å

PDB Description: horse methemoglobin high salt, ph 7.0 (88% relative humidity)
PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d2zlua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zlua_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltsky

SCOPe Domain Coordinates for d2zlua_:

Click to download the PDB-style file with coordinates for d2zlua_.
(The format of our PDB-style files is described here.)

Timeline for d2zlua_: