| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Hemoglobin, beta-chain [46500] (26 species) |
| Species Horse (Equus caballus) [TaxId:9796] [46504] (19 PDB entries) |
| Domain d2zltb_: 2zlt B: [154669] Other proteins in same PDB: d2zlta_ automated match to d1g0bb_ complexed with hem |
PDB Entry: 2zlt (more details), 1.9 Å
SCOPe Domain Sequences for d2zltb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zltb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahky
Timeline for d2zltb_: