| Class b: All beta proteins [48724] (176 folds) |
| Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
| Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins) |
| Protein Protease Do (DegP, HtrA), C-terminal domains [74934] (1 species) duplication: tandem repeat of two PDZ domains |
| Species Escherichia coli [TaxId:562] [74935] (4 PDB entries) |
| Domain d2zleb1: 2zle B:611-709 [154635] Other proteins in same PDB: d2zlea3, d2zleb3, d2zlec3, d2zlee3, d2zlef3, d2zleg3, d2zleh3, d2zlei3, d2zlej3, d2zlek3, d2zlel3, d2zlem3 automatically matched to d1ky9b1 |
PDB Entry: 2zle (more details), 28 Å
SCOPe Domain Sequences for d2zleb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zleb1 b.36.1.4 (B:611-709) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]}
vkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaakagikagdvitslngkpis
sfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqss
Timeline for d2zleb1:
View in 3DDomains from other chains: (mouse over for more information) d2zlea1, d2zlea2, d2zlea3, d2zlec1, d2zlec2, d2zlec3, d2zlee1, d2zlee2, d2zlee3, d2zlef1, d2zlef2, d2zlef3, d2zleg1, d2zleg2, d2zleg3, d2zleh1, d2zleh2, d2zleh3, d2zlei1, d2zlei2, d2zlei3, d2zlej1, d2zlej2, d2zlej3, d2zlek1, d2zlek2, d2zlek3, d2zlel1, d2zlel2, d2zlel3, d2zlem1, d2zlem2, d2zlem3 |