Lineage for d2zlca1 (2zlc A:123-419)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 777031Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 777046Species Rat (Rattus norvegicus) [TaxId:10116] [101432] (12 PDB entries)
  8. 777054Domain d2zlca1: 2zlc A:123-419 [154629]
    automatically matched to d1rkha_
    complexed with vdx

Details for d2zlca1

PDB Entry: 2zlc (more details), 2 Å

PDB Description: 2-Substituted-16-ene-22-thia-1alpha,25-dihydroxy-26,27-dimethyl-19-norvitamin D3 analogs: Synthesis, biological evaluation and crystal structure
PDB Compounds: (A:) Vitamin D3 receptor

SCOP Domain Sequences for d2zlca1:

Sequence, based on SEQRES records: (download)

>d2zlca1 a.123.1.1 (A:123-419) Vitamin D nuclear receptor {Rat (Rattus norvegicus) [TaxId: 10116]}
klseeqqhiiailldahhktydptyadfrdfrppvrmdgstgsvtldlsplsmlphladl
vsysiqkvigfakmipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdy
kydvtdvskaghtlelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklve
aiqdrlsntlqtyircrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmk
ltplvlevfg

Sequence, based on observed residues (ATOM records): (download)

>d2zlca1 a.123.1.1 (A:123-419) Vitamin D nuclear receptor {Rat (Rattus norvegicus) [TaxId: 10116]}
klseeqqhiiailldahhktydptyadfrdfrppvrmsplsmlphladlvsysiqkvigf
akmipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdykydvtdvskag
htlelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklveaiqdrlsntlq
tyircrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmkltplvlevfg

SCOP Domain Coordinates for d2zlca1:

Click to download the PDB-style file with coordinates for d2zlca1.
(The format of our PDB-style files is described here.)

Timeline for d2zlca1: