Lineage for d2zlba_ (2zlb A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1611695Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1611696Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1611697Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 1611723Protein automated matches [190251] (4 species)
    not a true protein
  7. 1611737Species Norway rat (Rattus norvegicus) [TaxId:10116] [187033] (22 PDB entries)
  8. 1611757Domain d2zlba_: 2zlb A: [154628]
    automated match to d1h1da_
    complexed with so4

Details for d2zlba_

PDB Entry: 2zlb (more details), 2.2 Å

PDB Description: Crystal structure of APO form of rat catechol-O-methyltransferase
PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d2zlba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zlba_ c.66.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
lelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdl
ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
vrgsssfecthyssyleymkvvdglekaiyqg

SCOPe Domain Coordinates for d2zlba_:

Click to download the PDB-style file with coordinates for d2zlba_.
(The format of our PDB-style files is described here.)

Timeline for d2zlba_: